DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and Rgk3

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001286670.1 Gene:Rgk3 / 5740446 FlyBaseID:FBgn0085426 Length:486 Species:Drosophila melanogaster


Alignment Length:199 Identity:50/199 - (25%)
Similarity:87/199 - (43%) Gaps:27/199 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MQTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFS 67
            ::.|::.::|..||||.|:..||..|..:..||       ..:|  ||....:.|:....:.|..
  Fly   232 VEFYRVEMLGSAGVGKQALLSQFRTSDCINAYD-------GPEC--DDAEQNVSIILNGTESELK 287

  Fly    68 AM-----REQYMRSGEGFLLVFALNDHSSFDEIPKFQRQIL-RVKDRD---EFPMLMVGNKCDLK 123
            .:     .:..:...:.||:|::..|..||..    .:||| |::|.|   ..|.::|.||.||.
  Fly   288 FLTGNPESKDELEQADAFLVVYSCIDKESFTR----AKQILSRLQDMDLLRHRPTILVANKIDLA 348

  Fly   124 HQQQVSLEEAQNTSRNLMIPYIECSAKLRVNVDQAFHELVRIVR----KFQIAERPFIEQDYKKK 184
            ..:.||.::.:..:......:||.|..:..|.|:.....:..:|    :.|:...|...:| |.|
  Fly   349 RSRAVSAQDGKCVACTFGAKFIEVSVGINHNCDELLAGTLTQIRLKKDQVQLQLNPKKSKD-KDK 412

  Fly   185 GKRK 188
            .|.|
  Fly   413 NKFK 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 42/171 (25%)
Rgk3NP_001286670.1 P-loop_NTPase 235..>396 CDD:422963 43/173 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453017
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.