DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and CG8500

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster


Alignment Length:190 Identity:64/190 - (33%)
Similarity:103/190 - (54%) Gaps:7/190 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QMQTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEF 66
            |...|::||.|.||||||::.::||:..|...|.|||||:|.:..:.:.....|.|.||.|..:|
  Fly    15 QSNDYRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTYRQVISCNKNICTLQITDTTGSHQF 79

  Fly    67 SAMREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRD--EFPMLMVGNKCD-LKHQQQV 128
            .||:...:..|..|:||:::....|.:|:......|..:|..|  ..|:::|||||| ....::|
  Fly    80 PAMQRLSISKGHAFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGNKCDETAELREV 144

  Fly   129 SLEEAQNTSRNLMIPYIECSAKLRVNVDQAFHELVRIVRKFQIAERPFIEQDYKKKGKRK 188
            |..|.|..:....|.::|.|||...||.:.|.||:.:.:...::    ::.|.||:.|:|
  Fly   145 SQAEGQAQATTWSISFMETSAKTNHNVTELFQELLNMEKTRTVS----LQLDTKKQKKQK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 58/165 (35%)
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 58/164 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453062
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.