DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and CG14669

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001262281.1 Gene:CG14669 / 40652 FlyBaseID:FBgn0037326 Length:306 Species:Drosophila melanogaster


Alignment Length:172 Identity:44/172 - (25%)
Similarity:78/172 - (45%) Gaps:17/172 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNI-DDVPAKLDILDTAGQEEFSAMR 70
            |...:|..||||::|..||....|...:..|......|.|.: |....:|.:||...|:.|.|  
  Fly    96 KAAFLGATGVGKTSILQQFFYHDFPRTHQTTTHRKIYKNCLVCDTCIRELMVLDVPPQKRFPA-- 158

  Fly    71 EQY----------MRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQ 125
            :.:          :|:...::||:.:.:..:|......:.|||......:|.:::||||.|...:
  Fly   159 DNFAEWNNGHPLGLRTVHAYVLVYDMGNLETFQYCRSMRDQILDSFSHRDFSIIVVGNKFDNVTE 223

  Fly   126 QQVSLEEAQNTS----RNLMIPYIECSAKLRVNVDQAFHELV 163
            .|.:.:|.::.|    ::....|:||||:....:...|.||:
  Fly   224 AQANSQELKDISTLVRKHWRCGYVECSAQYNYKIGDVFRELM 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 44/172 (26%)
CG14669NP_001262281.1 P-loop_NTPase 95..267 CDD:304359 44/172 (26%)
small_GTPase 96..265 CDD:197466 43/170 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453027
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.