DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and rhebl1

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_988937.1 Gene:rhebl1 / 394534 XenbaseID:XB-GENE-493839 Length:184 Species:Xenopus tropicalis


Alignment Length:191 Identity:60/191 - (31%)
Similarity:111/191 - (58%) Gaps:19/191 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFSAMRE 71
            |:|::|...||||::.:|||:..|..||:||||::::|...:.....:||::|||||:|:|.:.:
 Frog     8 KIVMLGYPSVGKSSLALQFIKGDFPKDYEPTIENTWSKTFVMGSDEFELDVVDTAGQDEYSLLPQ 72

  Fly    72 QYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDE--FPMLMVGNKCDL-KHQQQVSLEEA 133
            .::....|:::|:::....|| :|.:....|| |..|.:  .|:::||||.|| .|.::|..|:.
 Frog    73 SFIFGIHGYIVVYSVACSRSF-QIARAIHSIL-VDRRGKCLMPIVLVGNKNDLPTHCREVKPEDG 135

  Fly   134 QNTSRNLMIPYIECSAKLRVNVDQAFHELV--RIVRKFQIAERPFIEQDYKKKGKRKCCLM 192
            :..:.:....::|.|||     |....:|:  :::.:....||.|.|:       :|||:|
 Frog   136 KKLAESWGAAFLEVSAK-----DPERSKLIFTKMIEEIDRVERSFGEE-------KKCCVM 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 52/164 (32%)
rhebl1NP_988937.1 RheB 6..184 CDD:206709 59/189 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.