DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and ralaa

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_957312.1 Gene:ralaa / 393993 ZFINID:ZDB-GENE-040426-1344 Length:206 Species:Danio rerio


Alignment Length:194 Identity:87/194 - (44%)
Similarity:131/194 - (67%) Gaps:9/194 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFSAMR 70
            :|:::||.|||||||:|:||:...||.||:||..|||.|:..:|....::|||||||||:::|:|
Zfish    15 HKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIR 79

  Fly    71 EQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEEAQN 135
            :.|.|||||||.||::.:..||.....|:.||||||:.:..|.|:||||.||:.::|||.:||:.
Zfish    80 DNYFRSGEGFLCVFSITELESFAATADFREQILRVKEDENVPFLLVGNKSDLEDRRQVSADEAKA 144

  Fly   136 TSRNLMIPYIECSAKLRVNVDQAFHELVRIVRKFQIAERPFIEQDYKKKGK-------RKCCLM 192
            .:....:.|:|.|||.|.|||:.|.:|:|.:|..::.:..  |::.|||.|       .:||::
Zfish   145 RADQWGVCYVETSAKTRANVDKVFFDLMREIRARKMEDSK--EKNGKKKRKSLAKRIRERCCIL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 79/160 (49%)
ralaaNP_957312.1 RalA_RalB 15..177 CDD:206710 79/161 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.