DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and CG8519

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster


Alignment Length:167 Identity:48/167 - (28%)
Similarity:88/167 - (52%) Gaps:17/167 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFSAMRE 71
            |:.|:|...|||||:.::|:...::.:||...|:.|..:..:|..|...:||||..:.|     :
  Fly    17 KIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAE-----D 76

  Fly    72 QYMRSGE------GFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSL 130
            :|..:.|      |.|||:::.|..||:.|.:.:..:     :.:.|:.:..||.|:.|.:|||.
  Fly    77 EYPNAAELVQWADGLLLVYSITDRKSFNYIRRAKSDL-----QSDTPVQLCANKVDMVHLRQVSR 136

  Fly   131 EEAQNTSRNLMIPYIECSAKLRVN-VDQAFHELVRIV 166
            :|.:..:::....:.|.||...|: |.:.|:||.:.|
  Fly   137 DEGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 48/167 (29%)
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 47/165 (28%)
P-loop_NTPase 17..173 CDD:304359 47/165 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452981
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.