DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and Ric

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001163165.1 Gene:Ric / 36776 FlyBaseID:FBgn0265605 Length:264 Species:Drosophila melanogaster


Alignment Length:166 Identity:79/166 - (47%)
Similarity:121/166 - (72%) Gaps:0/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MQTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFS 67
            ::.||:|::|.|||||||:|:||:...|:..:||||||||.:|..||:..|.|||||||||.||:
  Fly    57 LRVYKIVILGDGGVGKSAVTLQFVSHSFLDYHDPTIEDSYQQQAVIDNEAALLDILDTAGQVEFT 121

  Fly    68 AMREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEE 132
            |||:||||.||||::.:::.|..||.|..::::.|.||:..::.|::::.||.||:.|::|:.||
  Fly   122 AMRDQYMRCGEGFIICYSVTDRHSFQEASEYRKLITRVRLSEDIPLVLIANKVDLESQRRVTTEE 186

  Fly   133 AQNTSRNLMIPYIECSAKLRVNVDQAFHELVRIVRK 168
            .:|.:.....|:.|.||.||..:|:||:.|||.:|:
  Fly   187 GRNLANQFGCPFFETSAALRHYIDEAFYTLVREIRR 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 78/162 (48%)
RicNP_001163165.1 Rit_Rin_Ric 58..229 CDD:206712 79/165 (48%)
small_GTPase 58..223 CDD:197466 79/165 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453036
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.