DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and Rras

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001101951.1 Gene:Rras / 361568 RGDID:1311443 Length:218 Species:Rattus norvegicus


Alignment Length:191 Identity:124/191 - (64%)
Similarity:149/191 - (78%) Gaps:2/191 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFSA 68
            :|:||||||||||||||:||||||||||:||||||||||||.|.:|.:||:||||||||||||.|
  Rat    28 ETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGIPARLDILDTAGQEEFGA 92

  Fly    69 MREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEEA 133
            |||||||:|.|||||||:||..||.|:.|...|||||||||:||:::||||.||:.|:||...||
  Rat    93 MREQYMRAGNGFLLVFAINDRQSFIEVSKLFTQILRVKDRDDFPIVLVGNKADLETQRQVLRSEA 157

  Fly   134 QNTSRNLMIPYIECSAKLRVNVDQAFHELVRIVRKFQIAERPFI--EQDYKKKGKRKCCLM 192
            .:.|.:..:.|.|.|||||:|||:||.:|||.|||:|..|.|..  ....||.|:..|.|:
  Rat   158 SSFSASHHMTYFEASAKLRLNVDEAFEQLVRTVRKYQEQELPPSPPSAPRKKDGRCPCVLL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 113/162 (70%)
RrasNP_001101951.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 0/1 (0%)
P-loop_NTPase 28..191 CDD:304359 113/162 (70%)
small_GTPase 42..193 CDD:197466 103/150 (69%)
Effector region 58..66 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340561
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1567
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.810

Return to query results.
Submit another query.