DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and kappaB-Ras

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001137613.1 Gene:kappaB-Ras / 35667 FlyBaseID:FBgn0040513 Length:201 Species:Drosophila melanogaster


Alignment Length:195 Identity:49/195 - (25%)
Similarity:86/195 - (44%) Gaps:33/195 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLVVVGGGGVGKSAITIQFIQSYF--VTDYDPTIEDSYTKQCNIDDVPAK--LDILDTAG-QEEF 66
            |::|.|..||||:|:..|.:..:.  .|:..|||||.|....:.....|:  |.|.|||| |.|.
  Fly    11 KVLVCGMKGVGKTALIEQLVYGHVNPETELHPTIEDIYVASVDTGRGGARETLRIYDTAGLQGEQ 75

  Fly    67 SAMREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNK------------ 119
            ..:...|::..:.|:||:...|..|.|.:...:..|.:.|::.|.|::::.|.            
  Fly    76 QQLPRHYLQFPDAFVLVYDPMDPRSLDMLADIKADIEKHKEKKEIPVVVLANVRARAAPNPVEKV 140

  Fly   120 -------CD---LKHQQQVSLEEAQNTSRNLMIPYIECSAKLR-VNVDQAFHELVRIVRKFQIAE 173
                   |.   :||....::|..     :|..|:....|:|. :.....|.:|.::::..|.:|
  Fly   141 MDRANIWCQRERIKHYTVNAMERP-----SLYEPFTTLCARLHPMQTKSTFPQLRQVMQNRQKSE 200

  Fly   174  173
              Fly   201  200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 47/187 (25%)
kappaB-RasNP_001137613.1 Ras 11..173 CDD:278499 43/166 (26%)
Ras_like_GTPase 13..174 CDD:206648 42/165 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453058
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.