DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and CG13375

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001162628.1 Gene:CG13375 / 30976 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster


Alignment Length:163 Identity:58/163 - (35%)
Similarity:90/163 - (55%) Gaps:5/163 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFSAMR 70
            :|:||:|...|||::|..||:.:.|.|.|..|||:.:....:|..|...||||||||..||.|||
  Fly    48 HKIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYEFPAMR 112

  Fly    71 EQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEEAQN 135
            ...:.|.:.|:||:.:.|.::|:|:...:.||...|.....|:::||||.||....:...|....
  Fly   113 ALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTAVPIVVVGNKIDLLADGETEREVEYA 177

  Fly   136 TSRNLMI-----PYIECSAKLRVNVDQAFHELV 163
            |:.:::.     .::|.||....|:.|.|.||:
  Fly   178 TTESVVTVDWENGFVEASASSNENITQVFKELL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 58/163 (36%)
CG13375NP_001162628.1 RAS 48..215 CDD:214541 58/163 (36%)
Ras_dva 49..239 CDD:206714 58/162 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453060
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.