DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and Rit2

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001013078.1 Gene:Rit2 / 291713 RGDID:1307654 Length:217 Species:Rattus norvegicus


Alignment Length:194 Identity:93/194 - (47%)
Similarity:125/194 - (64%) Gaps:11/194 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFSAMR 70
            ||:|::|.|||||||:|:|||...|...:||||||:|..|..||:.||.|||||||||.||:|||
  Rat    21 YKVVMLGAGGVGKSAVTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMR 85

  Fly    71 EQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEEAQN 135
            |||||.||||::.:::.|..||.|..||:..|.:|:...|.|:::||||.||:..:|||.||...
  Rat    86 EQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGMT 150

  Fly   136 TSRNLMIPYIECSAKLRVNVDQAFHELVRIVRK----FQIAERPFIEQD--YKK-----KGKRK 188
            .:|:....:.|.||.||..:|.||..|||.:|:    ..:.||....:|  :||     |.||:
  Rat   151 LARDYNCAFFETSAALRFGIDDAFQGLVREIRRKESMLSLVERKLKRKDSLWKKIKASLKKKRE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 84/160 (53%)
Rit2NP_001013078.1 Rit_Rin_Ric 19..190 CDD:206712 85/168 (51%)
small_GTPase 19..184 CDD:197466 85/162 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.