DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and Mras

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_038936811.1 Gene:Mras / 25482 RGDID:3111 Length:236 Species:Rattus norvegicus


Alignment Length:187 Identity:105/187 - (56%)
Similarity:140/187 - (74%) Gaps:7/187 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MQTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFS 67
            :.||||||||.|||||||:||||.|..||.||||||||||.|...||:..|.||:||||||||||
  Rat    39 LPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAGQEEFS 103

  Fly    68 AMREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEE 132
            ||||||||:|:|||:|:::.|.:||:.:.:|.:.|||||||:.|||::|.||.||.|.::::.::
  Rat   104 AMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKITRDQ 168

  Fly   133 AQNTSRNLMIPYIECSAK-LRVNVDQAFHELVRIVRKFQIAERPFIEQDYKKKGKRK 188
            .:..:....|||||.||| ..:|||:.||:|||::|: |:.|:     :.|||.|.|
  Rat   169 GKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIRQ-QVPEK-----NQKKKKKTK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 97/163 (60%)
MrasXP_038936811.1 M_R_Ras_like 40..204 CDD:133345 97/163 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.