DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and ras1

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_593579.1 Gene:ras1 / 2542285 PomBaseID:SPAC17H9.09c Length:219 Species:Schizosaccharomyces pombe


Alignment Length:217 Identity:111/217 - (51%)
Similarity:149/217 - (68%) Gaps:31/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MQTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFS 67
            ::.|||||||.|||||||:|||.|||:||.:|||||||||.|:|.||...|.||:||||||||:|
pombe     6 LREYKLVVVGDGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKKCEIDGEGALLDVLDTAGQEEYS 70

  Fly    68 AMREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEE 132
            ||||||||:|||||||:.:...||||||..|.:|||||||:|.||:::|.|||||:.::.||..|
pombe    71 AMREQYMRTGEGFLLVYNITSRSSFDEISTFYQQILRVKDKDTFPVVLVANKCDLEAERVVSRAE 135

  Fly   133 AQNTSRNLMIPYIECSAKLRVNVDQAFHELVRIVRKFQIAERPFIEQDYKKK------------G 185
            .:..::::...|:|.|||||:||::||:.|||.:|::..:|    |:.::.|            .
pombe   136 GEQLAKSMHCLYVETSAKLRLNVEEAFYSLVRTIRRYNKSE----EKGFQNKQAVQTAQVPASTA 196

  Fly   186 KR---------------KCCLM 192
            ||               |||::
pombe   197 KRASAVNNSKTEDEVSTKCCVI 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 102/162 (63%)
ras1NP_593579.1 small_GTPase 7..172 CDD:197466 103/164 (63%)
H_N_K_Ras_like 8..170 CDD:133338 102/161 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6945
Inparanoid 1 1.050 217 1.000 Inparanoid score I919
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100217
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 1 1.000 - - X1567
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.