DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and RASD2

DIOPT Version :10

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_055125.2 Gene:RASD2 / 23551 HGNCID:18229 Length:266 Species:Homo sapiens


Alignment Length:188 Identity:73/188 - (38%)
Similarity:104/188 - (55%) Gaps:30/188 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFSAM 69
            :|::||:|...||||:|..:|:...|...|.|||||.:.|..||.....:||||||:|...|.||
Human    19 SYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAM 83

  Fly    70 REQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRV--------KDRDEFPMLMVGNKCDLKHQQ 126
            |...:.:|:.|:|||:|::..||||:.:.|:|||.|        |:..|.||::.|||.|  |.:
Human    84 RRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKND--HGE 146

  Fly   127 ---QVSLEEAQNTSRNLMI------PYIECSAKLRVNVDQAFHELVRIVRKFQIAERP 175
               ||...||:     |::      .|.|.|||...|||:.|:.|      |.:|:.|
Human   147 LCRQVPTTEAE-----LLVSGDENCAYFEVSAKKNTNVDEMFYVL------FSMAKLP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 70/178 (39%)
RASD2NP_055125.2 Rhes_like 20..266 CDD:133343 73/187 (39%)
Effector region 48..56 6/7 (86%)
Interaction with GNB1, GNB2 and GNB3. /evidence=ECO:0000269|PubMed:19255495 189..235 2/5 (40%)

Return to query results.
Submit another query.