DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and Rerg

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001157684.1 Gene:Rerg / 232441 MGIID:2665139 Length:199 Species:Mus musculus


Alignment Length:168 Identity:70/168 - (41%)
Similarity:104/168 - (61%) Gaps:2/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFSAMRE 71
            ||.:.|..|||||||.::|:...|:.:||||:|.:|..|..|||....::||||||||: :..||
Mouse     8 KLAIFGRAGVGKSAIVVRFLTKRFIWEYDPTLESTYRHQATIDDEVVSMEILDTAGQED-TIQRE 71

  Fly    72 QYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEEAQNT 136
            .:||.||||:||:.:.|..||:|:...:..:..||......:::||||.||.|.:|||.||.:..
Mouse    72 GHMRWGEGFVLVYDITDRGSFEEVLPLKNILDEVKKPKNVTLILVGNKADLDHSRQVSTEEGEKL 136

  Fly   137 SRNLMIPYIECSAKL-RVNVDQAFHELVRIVRKFQIAE 173
            :..|...:.||||.. ..|:.:.|:||.|.||:.::.:
Mouse   137 ATELACAFYECSACTGEGNITEVFYELCREVRRRRMVQ 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 68/160 (43%)
RergNP_001157684.1 RERG_RasL11_like 8..169 CDD:206713 69/161 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.