DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and drn-1

DIOPT Version :10

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001333544.2 Gene:drn-1 / 183765 WormBaseID:WBGene00016911 Length:219 Species:Caenorhabditis elegans


Alignment Length:77 Identity:17/77 - (22%)
Similarity:28/77 - (36%) Gaps:16/77 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   452 HLAQRLQNEET---------GSSSSTTPSKRRILGKEKVNSKPKKQK-------PDQKDSSKHIP 500
            |...||:|:.|         ||||.|..:.....|........:|:.       |....:::.:.
 Worm    13 HGLGRLRNKITTQPLDIKGEGSSSKTVAAVAGSPGTPTTPGSARKENVWRSVFHPGSNIATRGMG 77

  Fly   501 IHAFFTKSNQNS 512
            .:.|...|:.||
 Worm    78 TNLFDKPSHPNS 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345
drn-1NP_001333544.2 P-loop containing Nucleoside Triphosphate Hydrolases 30..195 CDD:476819 12/60 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.