DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and RHEBL1

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_653194.1 Gene:RHEBL1 / 121268 HGNCID:21166 Length:183 Species:Homo sapiens


Alignment Length:186 Identity:49/186 - (26%)
Similarity:100/186 - (53%) Gaps:10/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFSAMRE 71
            |:|::|...|||:::..||::..|...||||:|::|:|...:......|.::|||||:|:|.:..
Human     8 KVVILGYRCVGKTSLAHQFVEGEFSEGYDPTVENTYSKIVTLGKDEFHLHLVDTAGQDEYSILPY 72

  Fly    72 QYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEEAQNT 136
            .::....|::||:::....||..|....:::.....:...|:::||||.||..:::|...|.:..
Human    73 SFIIGVHGYVLVYSVTSLHSFQVIESLYQKLHEGHGKTRVPVVLVGNKADLSPEREVQAVEGKKL 137

  Fly   137 SRNLMIPYIECSAKLRVNVDQAFHELVRIVRKFQIAERPFIEQDYKKKGKRKCCLM 192
            :.:....::|.||:........|.::::.:.:        :|..|.:  :|:|.||
Human   138 AESWGATFMESSARENQLTQGIFTKVIQEIAR--------VENSYGQ--ERRCHLM 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 43/159 (27%)
RHEBL1NP_653194.1 small_GTPase 5..169 CDD:197466 43/160 (27%)
RheB 6..183 CDD:206709 47/184 (26%)
Effector region 35..43 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.