DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and mrasa

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_003199272.1 Gene:mrasa / 100536317 ZFINID:ZDB-GENE-110411-67 Length:208 Species:Danio rerio


Alignment Length:187 Identity:108/187 - (57%)
Similarity:136/187 - (72%) Gaps:7/187 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MQTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFS 67
            :.||||||||.|||||||:||||.|..||.||||||||||.|...||...|.||:||||||||||
Zfish    11 LPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQWAILDVLDTAGQEEFS 75

  Fly    68 AMREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEE 132
            ||||||||:|:|||:||::.|.:||:.:.:|.:.|||||||:.|||::|.||.||.|.::|:.|:
Zfish    76 AMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFPMVLVANKVDLVHLRKVTNEQ 140

  Fly   133 AQNTSRNLMIPYIECSAK-LRVNVDQAFHELVRIVRKFQIAERPFIEQDYKKKGKRK 188
            ....:....|.|||.||| ..:||::|||||||::|: |:.     |...|||.|.|
Zfish   141 GCEMAAKHNITYIETSAKDPPMNVERAFHELVRVIRQ-QVP-----EHSLKKKKKMK 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 100/163 (61%)
mrasaXP_003199272.1 P-loop_NTPase 12..176 CDD:328724 100/163 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.