DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and krasl

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_004920180.1 Gene:krasl / 100485959 XenbaseID:XB-GENE-22063560 Length:226 Species:Xenopus tropicalis


Alignment Length:193 Identity:105/193 - (54%)
Similarity:142/193 - (73%) Gaps:7/193 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MQTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFS 67
            |..|||||||.|||||||:|||.||::||.:|||||||||.||..||.....|||||||||||:|
 Frog     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65

  Fly    68 AMREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEE 132
            |||:||||:|||||.|||:|:..||::|..::.||.||||.::.||::|||||||. .:.|..::
 Frog    66 AMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLP-SRTVDTKQ 129

  Fly   133 AQNTSRNLMIPYIECSAKLRVNVDQAFHELVRIVRKFQIAERPFIEQDYKKKG---KRKCCLM 192
            ||:.:|:..||:||.|||.|..|:.||:.|||.:|::::.:   :.::.|..|   .:||.:|
 Frog   130 AQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKK---MSKEEKTPGCVKVKKCRVM 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 98/162 (60%)
kraslXP_004920180.1 H_N_K_Ras_like 3..164 CDD:133338 98/161 (61%)
RAS 16..166 CDD:214541 88/150 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.