Sequence 1: | NP_523917.2 | Gene: | Ras64B / 38494 | FlyBaseID: | FBgn0003206 | Length: | 192 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031753456.1 | Gene: | rerg / 100134997 | XenbaseID: | XB-GENE-489597 | Length: | 228 | Species: | Xenopus tropicalis |
Alignment Length: | 197 | Identity: | 64/197 - (32%) |
---|---|---|---|
Similarity: | 104/197 - (52%) | Gaps: | 31/197 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 KLVVVGGGGVGKS-----------------------------AITIQFIQSYFVTDYDPTIEDSY 42
Fly 43 TKQCNIDDVPAKLDILDTAGQEEFSAMREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKD 107
Fly 108 RDEFPMLMVGNKCDLKHQQQVSLEEAQNTSRNLMIPYIECSAKL-RVNVDQAFHELVRIVRKFQI 171
Fly 172 AE 173 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ras64B | NP_523917.2 | M_R_Ras_like | 4..167 | CDD:133345 | 62/189 (33%) |
rerg | XP_031753456.1 | RERG_RasL11_like | 8..198 | CDD:206713 | 63/190 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24070 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.010 |