DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ras64B and rerg

DIOPT Version :9

Sequence 1:NP_523917.2 Gene:Ras64B / 38494 FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_031753456.1 Gene:rerg / 100134997 XenbaseID:XB-GENE-489597 Length:228 Species:Xenopus tropicalis


Alignment Length:197 Identity:64/197 - (32%)
Similarity:104/197 - (52%) Gaps:31/197 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLVVVGGGGVGKS-----------------------------AITIQFIQSYFVTDYDPTIEDSY 42
            |:.::|..|||||                             ::.::|:...|:.:||||:|.:|
 Frog     8 KIAILGRAGVGKSGSYLLLGHEWVIKKTAVKCTAHLHHQASLSLVVRFLTKRFIWEYDPTLESTY 72

  Fly    43 TKQCNIDDVPAKLDILDTAGQEEFSAMREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKD 107
            ..|..|||....:::|||||||: :..||.::|..:||.:|:.:.|..||||:..|:..:..:|.
 Frog    73 RHQATIDDDLVTMELLDTAGQED-TIQREGHVRWADGFAIVYDITDKGSFDEVLPFKNLLDEIKK 136

  Fly   108 RDEFPMLMVGNKCDLKHQQQVSLEEAQNTSRNLMIPYIECSAKL-RVNVDQAFHELVRIVRKFQI 171
            ......::||||.||.|.:|||.||.:..:..|...:.||||.. ..|:.:||:||.|.||:.::
 Frog   137 PKNVTFILVGNKADLDHCRQVSTEEGEKLATELACAFYECSACTGEGNISEAFYELCREVRRRKM 201

  Fly   172 AE 173
            .:
 Frog   202 VQ 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 62/189 (33%)
rergXP_031753456.1 RERG_RasL11_like 8..198 CDD:206713 63/190 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.