DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rop and car

DIOPT Version :9

Sequence 1:NP_001261404.1 Gene:Rop / 38493 FlyBaseID:FBgn0004574 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001259707.1 Gene:car / 32947 FlyBaseID:FBgn0000257 Length:639 Species:Drosophila melanogaster


Alignment Length:641 Identity:124/641 - (19%)
Similarity:240/641 - (37%) Gaps:148/641 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RVLVVDKLGMRMVSACTKMHEISAEGITLVEDINKKREPLPTMDAIYLITPSDESVRGLIRDFEN 104
            :|:|:|:..:..:...|:....:..||.|:....:...|....:.:|::.|....:..|....:.
  Fly    36 KVIVLDETMIGPLDLVTRPKLFADRGIRLLALKPELHLPREVANVVYVMRPRVALMEQLAAHVKA 100

  Fly   105 PARPMY-RYAHVFFTE----VCPEELFNDLCKSCAAGKIKTLKEINIAFLPYECQVFSLDSPDTF 164
            ..|... |..|:.|..    :|..:|.    .|...|....::|:...:||.:..:.|::.|:.|
  Fly   101 GGRAAAGRQYHILFAPRRSCLCVSQLE----VSGVLGSFGNIEELAWNYLPLDVDLVSMEMPNAF 161

  Fly   165 Q---------CLYSPAFASIRSKHIERIAEQIATLCATLGEYPNVRYRSDWDRNIDLAASVQQKL 220
            :         .||..|...::   ::|:          .|..|.:..:.::      |..|.:..
  Fly   162 RDVSVDGDTSSLYQAAVGLVQ---LQRL----------YGRIPKIYGKGEF------AHRVWEHA 207

  Fly   221 DAYKADDATMGEGPEKARSQLLILDRGFDCVSPLLHELTLQAMAYDLLPIVNDVY-----RYT-P 279
            .....|:.|:..|.:....||::|||..|.:|||..:||.:.       ::::.|     :.| |
  Fly   208 KQLGRDERTLYNGDKGVVDQLILLDRSIDLLSPLATQLTYEG-------LIDEFYGIRQNKLTLP 265

  Fly   280 GPNQPD--------------------------KEVLLDENDDLWVELRHEHIAVVSTQVTQNLKK 318
            ..|.|.                          |.:||...:.|:.|||::|...|:..:.:..::
  Fly   266 AENFPSDGALPGGGGSGPRVEESQSLLGDTEKKTILLHSGEQLYAELRNKHFNEVTKLLARKARE 330

  Fly   319 FTDSKRMGSADKSSMRDLSQMIKKMPQYQKELSKYSTH------LHLAEDCMKSYQNYVDKLCRV 377
            ........|.|||.....|.:...:||...:....|.|      ||...:.::    :.|.|. .
  Fly   331 IHVQMHATSQDKSVQEIKSFVENLLPQLMAQKKATSEHTAIAGLLHEQVNAVR----FADDLA-A 390

  Fly   378 EQDLAMGTDAEGEKIKDHMRNIVPILLDANVSNYDKVRIIALYVMIKNGISEENLTKLFTHAQLS 442
            ||:..:..|.  :|...::.:::...::.|    ..:|:|.:.....:|..|    ||..|.:  
  Fly   391 EQEFMVCADI--DKPSAYIEDLIACRVELN----RVLRLICMQCHAASGFKE----KLLNHYK-- 443

  Fly   443 PKDQDMVR-----------NLSCLGINVIADSRKKQYSVPRKE-----------RTTESTYQMSR 485
               :::|.           ||...|: :...:..:.|||.||.           ...:.:|..|.
  Fly   444 ---RELVHVYGLEVLLTISNLEKSGL-LHLQTESRAYSVLRKTLHLTVDDNVEIEPKDISYVHSF 504

  Fly   486 WTPVIKDIMEDCIED------KLDLRHFP---FLEGRAQNTNY---HAPTSARYGHWHKDKGQAQ 538
            :.|:...|:|..::.      |..:.:.|   |.:.:||....   |..|:...|         .
  Fly   505 YAPLTARIVEHSLKPLGWQTLKSQINNLPGPTFEDFQAQLVGIGGRHTVTTVSEG---------S 560

  Fly   539 VKNVPRLI-VFIVGGVSMSEMRC-AYEVTNAVRNWEVLVGSSHILSPEIFLSDLGS 592
            :.||||:: |..|||.:.:|:.. .:.......|.|.|:.::.:::...||..|.|
  Fly   561 LLNVPRVVLVCFVGGCTFAEIAALRFLAAQEDNNVEFLIATTKVVNKHSFLDSLMS 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RopNP_001261404.1 Sec1 40..583 CDD:395791 120/630 (19%)
carNP_001259707.1 Sec1 36..606 CDD:279352 120/629 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464248
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5158
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11679
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.