DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC4 and RFC3

DIOPT Version :9

Sequence 1:NP_523915.1 Gene:RfC4 / 38492 FlyBaseID:FBgn0260985 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_177871.1 Gene:RFC3 / 844083 AraportID:AT1G77470 Length:369 Species:Arabidopsis thaliana


Alignment Length:316 Identity:115/316 - (36%)
Similarity:180/316 - (56%) Gaps:10/316 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PWIEKYRPVKFKEIVGNEDTVARLSVFATQGNAPNIIIAGPPGVGKTTTIQCLARILLGDSYKEA 81
            ||:|||||....::..:.|.:..:.....:...|::::.||||.|||:||..:||.|.|..|:..
plant    40 PWVEKYRPQSLDDVAAHRDIIDTIDRLTNENKLPHLLLYGPPGTGKTSTILAVARKLYGPKYRNM 104

  Fly    82 VLELNASNERGIDVVRNKIKMFAQ-QKVTLPRGRHKIVILDEADSMTEGAQQALRRTMEIYSSTT 145
            :||||||::|||||||.:|:.||. |..:|.:...|:|:|||||:||:.||.||||.:|.|:.:|
plant   105 ILELNASDDRGIDVVRQQIQDFASTQSFSLGKSSVKLVLLDEADAMTKDAQFALRRVIEKYTKST 169

  Fly   146 RFALACNTSEKIIEPIQSRCAMLRFTKLSDAQVLAKLIEVAKWEKLNYTEDGLEAIVFTAQGDMR 210
            ||||..|...|||..:||||...||..|....:..:|..|.:.|:|..::.||.|:|..:.||||
plant   170 RFALIGNHVNKIIPALQSRCTRFRFAPLDGVHMSQRLKHVIEAERLVVSDCGLAALVRLSNGDMR 234

  Fly   211 QGLNNLQSTAQGFGDITAENVFKVCDE--------PHPKLLEEMIHHCAANDIHKAYKILAKL-W 266
            :.||.||||.....:||.|...::.:|        |.||.:|::.|........:.||.:::: .
plant   235 KALNILQSTHMASKEITEEESKQITEEDVYLCTGNPLPKDIEQISHWLLNKPFDECYKDVSEIKT 299

  Fly   267 KLGYSPEDIIANIFRVCKRINIDEHLKLDFIREIGITHMKIIDGINSLLQLTALLA 322
            :.|.:..||:..|.....:|.:...:::..|.::.....::..|.|..|||.|:::
plant   300 RKGLAIVDIVKEITLFIFKIKMPSAVRVQLINDLADIEYRLSFGCNDKLQLGAIIS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC4NP_523915.1 PLN03025 16..330 CDD:178596 115/316 (36%)
AAA 31..165 CDD:99707 62/134 (46%)
Rep_fac_C 254..322 CDD:285713 14/68 (21%)
RFC3NP_177871.1 rfc 39..357 CDD:234763 115/316 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 1 1.000 - - FOG0000505
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100321
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.