DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC4 and EMB1968

DIOPT Version :9

Sequence 1:NP_523915.1 Gene:RfC4 / 38492 FlyBaseID:FBgn0260985 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001185061.1 Gene:EMB1968 / 838771 AraportID:AT1G21690 Length:341 Species:Arabidopsis thaliana


Alignment Length:286 Identity:111/286 - (38%)
Similarity:160/286 - (55%) Gaps:9/286 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RSHLPWIEKYRPVKFKEIVGNEDTVARLSVFATQGNAPNIIIAGPPGVGKTTTIQCLARILLG-D 76
            :|..||:|||||.:.|::...|:.|..|:......:.|:::..||||.|||||...:|..|.| :
plant     6 QSSQPWVEKYRPKQVKDVAHQEEVVRVLTNTLQTADCPHMLFYGPPGTGKTTTALAIAHQLFGPE 70

  Fly    77 SYKEAVLELNASNERGIDVVRNKIKMFA-------QQKVTLPRGRHKIVILDEADSMTEGAQQAL 134
            .||..|||||||::|||:|||.|||.||       .::...|....||:||||||||||.||.||
plant    71 LYKSRVLELNASDDRGINVVRTKIKDFAAVAVGSNHRQSGYPCPSFKIIILDEADSMTEDAQNAL 135

  Fly   135 RRTMEIYSSTTRFALACNTSEKIIEPIQSRCAMLRFTKLSDAQVLAKLIEVAKWEKLNYTEDGLE 199
            |||||.||..|||...||...:||||:.||||..||..||:..:..:::.:...|.|:...:.|.
plant   136 RRTMETYSKVTRFFFICNYISRIIEPLASRCAKFRFKPLSEEVMSNRILHICNEEGLSLDGEALS 200

  Fly   200 AIVFTAQGDMRQGLNNLQSTAQGFGD-ITAENVFKVCDEPHPKLLEEMIHHCAANDIHKAYKILA 263
            .:...:|||:|:.:..|||..:.||. ||:.::..|......:::.::...|.:.|...|.|.:.
plant   201 TLSSISQGDLRRAITYLQSATRLFGSTITSTDLLNVSGVVPLEVVNKLFTACKSGDFDIANKEVD 265

  Fly   264 KLWKLGYSPEDIIANIFRVCKRINID 289
            .:...||....||..:|.:....:.|
plant   266 NIVAEGYPASQIINQLFDIVAEADSD 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC4NP_523915.1 PLN03025 16..330 CDD:178596 110/283 (39%)
AAA 31..165 CDD:99707 70/141 (50%)
Rep_fac_C 254..322 CDD:285713 9/36 (25%)
EMB1968NP_001185061.1 PRK12402 11..308 CDD:237090 109/281 (39%)
AAA 26..166 CDD:99707 70/139 (50%)
AAA_assoc_2 189..>220 CDD:292811 9/30 (30%)
Rep_fac_C 256..>309 CDD:285713 9/36 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 1 1.000 - - FOG0000505
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.