DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC4 and EMB2775

DIOPT Version :9

Sequence 1:NP_523915.1 Gene:RfC4 / 38492 FlyBaseID:FBgn0260985 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_198126.1 Gene:EMB2775 / 832836 AraportID:AT5G27740 Length:354 Species:Arabidopsis thaliana


Alignment Length:345 Identity:86/345 - (24%)
Similarity:156/345 - (45%) Gaps:46/345 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WIEKYRPVKFKEIVGNEDTVARLSVFATQGNAPNIIIAGPPGVGKTTTIQCLARILLGDSYKEAV 82
            |::||||....:::.:||...:|....::.:.|:::..||.|.||.|.|..|.:.:.|.|.::..
plant     3 WVDKYRPKSLDKVIVHEDIAQKLKKLVSEQDCPHLLFYGPSGSGKKTLIMALLKQIYGASAEKVK 67

  Fly    83 LELNA----SNERGID-------------------------VVRNKIKMFAQQKVTLPRGR--HK 116
            :|..|    :..|.||                         :|:..||..|:.:....:|:  :|
plant    68 VENRAWKVDAGSRTIDLELTTLSSTNHVELTPSDAGFQDRYIVQEIIKEMAKNRPIDTKGKKGYK 132

  Fly   117 IVILDEADSMTEGAQQALRRTMEIYSSTTRFALACNTSEKIIEPIQSRCAMLRFTKLSDAQVLAK 181
            :::|:|.|.::..||.:||||||.|||:.|..|.||:|.|:.|.|:|||..:|....|..:::..
plant   133 VLVLNEVDKLSREAQHSLRRTMEKYSSSCRLILCCNSSSKVTEAIKSRCLNVRINAPSQEEIVKV 197

  Fly   182 LIEVAKWEKLNYTEDGLEAIVFTAQGDMRQGLNNLQSTAQGFGDITAENVFKVCDEPHPKLLEEM 246
            |..|||.|.|...:.....|...:...:|:.:.:|::........|...|....|      .||.
plant   198 LEFVAKKESLQLPQGFAARIAEKSNRSLRRAILSLETCRVQNYPFTGNQVISPMD------WEEY 256

  Fly   247 IHHCAANDI-----HKAYKILAKLWKLGYS---PEDIIANIFRVCKRINIDEHLKLDFIREIGIT 303
            :...|.:.:     .|.:::..|:::|..:   ||.|:..:.....: .:|..|||:........
plant   257 VAEIATDMMKEQSPKKLFQVRGKVYELLVNCIPPEVILKRLLHELLK-KLDSELKLEVCHWAAYY 320

  Fly   304 HMKIIDGINSLLQLTALLAK 323
            ..::..|..::..:.|.:||
plant   321 EHRMRLGQKAIFHIEAFVAK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC4NP_523915.1 PLN03025 16..330 CDD:178596 86/345 (25%)
AAA 31..165 CDD:99707 48/164 (29%)
Rep_fac_C 254..322 CDD:285713 12/75 (16%)
EMB2775NP_198126.1 rfc 2..341 CDD:234763 86/345 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.