DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC4 and Rfc3

DIOPT Version :9

Sequence 1:NP_523915.1 Gene:RfC4 / 38492 FlyBaseID:FBgn0260985 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_081285.1 Gene:Rfc3 / 69263 MGIID:1916513 Length:356 Species:Mus musculus


Alignment Length:365 Identity:93/365 - (25%)
Similarity:152/365 - (41%) Gaps:75/365 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WIEKYRPVKFKEIVGNEDTVARLSVFATQGNAPNIIIAGPPGVGKTTTIQCLARILLG------- 75
            |::||||.....:..:::..|:|......|:.|::::.||.|.||.|.|.|:.|.|.|       
Mouse     4 WVDKYRPSSLARLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGIGVEKLR 68

  Fly    76 --------DSYKEAV---------LELNASNERGID--VVRNKIKMFA--QQKVTLPRGRHKIVI 119
                    .|.|:..         ||:|.|:....|  |::..:|..|  ||..|..:...|:|:
Mouse    69 IEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETSSQRDFKVVL 133

  Fly   120 LDEADSMTEGAQQALRRTMEIYSSTTRFALACNTSEKIIEPIQSRCAMLRFTKLSDAQVLAKLIE 184
            |.|.|.:|:.||.|||||||.|.||.|..|.||::.|:|.||:|||..:|....|...:.:.|..
Mouse   134 LTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICSVLST 198

  Fly   185 VAKWEKLNYTEDGLEAIVFTAQGDMRQGLNNLQSTAQGFGDITAENVFK---VC----------- 235
            |.:                      ::||....:.|:...:.:..|:.|   :|           
Mouse   199 VCR----------------------KEGLALPSTLARRLAEKSCRNLRKALLMCEACRVQQYPFT 241

  Fly   236 -DEPHPKLLEEMIHHCAANDI------HKAYKILAKLWKL---GYSPEDIIANIFRVCKRINIDE 290
             |:..|:...|:.....||.|      .:..::..:|::|   ...||.|:..:...... |.|.
Mouse   242 EDQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLH-NCDG 305

  Fly   291 HLKLDFIREIGITHMKIIDGINSLLQLTALLAKLCIAAEK 330
            .||.:..:.......::..|..::..|.|.:||.....:|
Mouse   306 QLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKK 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC4NP_523915.1 PLN03025 16..330 CDD:178596 92/363 (25%)
AAA 31..165 CDD:99707 55/161 (34%)
Rep_fac_C 254..322 CDD:285713 13/76 (17%)
Rfc3NP_081285.1 PRK12402 3..339 CDD:237090 91/357 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.