DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC4 and RFC4

DIOPT Version :9

Sequence 1:NP_523915.1 Gene:RfC4 / 38492 FlyBaseID:FBgn0260985 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_002907.1 Gene:RFC4 / 5984 HGNCID:9972 Length:363 Species:Homo sapiens


Alignment Length:320 Identity:120/320 - (37%)
Similarity:177/320 - (55%) Gaps:9/320 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KRSHLPWIEKYRPVKFKEIVGNEDTVARLSVFATQGNAPNIIIAGPPGVGKTTTIQCLARILLG- 75
            |...:||:|||||....|:...|:.||.|.......:.||::..||||.|||:||...||.|.| 
Human    34 KAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGP 98

  Fly    76 DSYKEAVLELNASNERGIDVVRNKIKMFAQQKVTLPR--GR----HKIVILDEADSMTEGAQQAL 134
            :.::..|||||||:||||.|||.|:|.|||..|:..|  |:    .||||||||||||..||.||
Human    99 ELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAAL 163

  Fly   135 RRTMEIYSSTTRFALACNTSEKIIEPIQSRCAMLRFTKLSDAQVLAKLIEVAKWEKLNYTEDGLE 199
            |||||..|.||||.|.||...:||||:.|||:..||..|||.....:|:::||.|.:..:::|:.
Human   164 RRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIA 228

  Fly   200 AIVFTAQGDMRQGLNNLQSTAQ--GFGDITAENVFKVCDEPHPKLLEEMIHHCAANDIHKAYKIL 262
            .:|..::||:|:.:..|||..:  |..:||.:.:..:......:.::.:...|.:....|...::
Human   229 YLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVV 293

  Fly   263 AKLWKLGYSPEDIIANIFRVCKRINIDEHLKLDFIREIGITHMKIIDGINSLLQLTALLA 322
            ..|...|::...::..:..|....|:.:..|.....::......:.||.:..|||.:|.|
Human   294 KDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC4NP_523915.1 PLN03025 16..330 CDD:178596 119/316 (38%)
AAA 31..165 CDD:99707 75/140 (54%)
Rep_fac_C 254..322 CDD:285713 12/67 (18%)
RFC4NP_002907.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 1/1 (100%)
Rad17 39..353 CDD:330523 118/313 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 1 1.000 - - FOG0000505
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.