DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC4 and rad17

DIOPT Version :9

Sequence 1:NP_523915.1 Gene:RfC4 / 38492 FlyBaseID:FBgn0260985 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_005171890.1 Gene:rad17 / 436934 ZFINID:ZDB-GENE-040718-409 Length:666 Species:Danio rerio


Alignment Length:279 Identity:51/279 - (18%)
Similarity:101/279 - (36%) Gaps:64/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PEEPEKTADDKRSHLPWIEKYRPVKFKEIVGNEDTV------ARLSVFATQGNAPNIIIAGPPGV 60
            |::.|          ||::.:.|....|:..::..|      .|:.:..::.....:::.||.|.
Zfish    74 PDQDE----------PWVDIHAPQSQAELAVHKKKVEEVESWLRVHLDKSKKGGAILLLTGPSGC 128

  Fly    61 GKTTTIQCLARIL-----------LGDSYKEAVL------------ELNASNERGI---DVVR-N 98
            |||.|:|.||:.|           ....||...|            ..:.|::.|:   .::| |
Zfish   129 GKTATVQVLAKELGFQVQEWSNPSTTSQYKTEDLFTQSFDPDSRFNRFHGSSQTGLFQEFLLRAN 193

  Fly    99 KIKMFAQQKVTLPRGRHKIVILDEADSMTEGAQQALRRTMEIYSSTTRFALACNTSEKIIEPIQS 163
            |.........|....| ||::::|..:........|...:..:....|..|....|:.:.....|
Zfish   194 KYSRLRMSGETWTEDR-KIILIEEFPNQFYRQPGCLHDILRQFIKCGRCPLVLIVSDSLSGDKNS 257

  Fly   164 RCAM-----------LRFTKLSDAQVLAKLIEVAKWEKLNYT-------EDGLEAIVFTAQGDMR 210
            |...           :.|..::...::..|..:...|.:..:       :..|:.:...:.||:|
Zfish   258 RLLFKDVLQELGIHNISFNPVAPTSMMKVLSRIVTIEAVKSSGRISVPDKAALDLLCSGSSGDIR 322

  Fly   211 QGLNNLQSTAQGFGDITAE 229
            ..:|:||.::  |.|.:.|
Zfish   323 SAINSLQFSS--FTDNSLE 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC4NP_523915.1 PLN03025 16..330 CDD:178596 49/265 (18%)
AAA 31..165 CDD:99707 31/166 (19%)
Rep_fac_C 254..322 CDD:285713
rad17XP_005171890.1 rad24 15..638 CDD:129690 51/279 (18%)
P-loop_NTPase 120..>165 CDD:304359 14/44 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.