DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC4 and CG8142

DIOPT Version :9

Sequence 1:NP_523915.1 Gene:RfC4 / 38492 FlyBaseID:FBgn0260985 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_573245.1 Gene:CG8142 / 32763 FlyBaseID:FBgn0030871 Length:353 Species:Drosophila melanogaster


Alignment Length:293 Identity:115/293 - (39%)
Similarity:161/293 - (54%) Gaps:38/293 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PWIEKYRPVKFKEIVGNEDTVARLSVFATQGNAPNIIIAGPPGVGKTTTIQCLARILLGDSYKEA 81
            ||:|||||....::|...:.||.|......|:.||:::.||||.|||:||...:|.:.||.:|:.
  Fly    31 PWVEKYRPRNVDDVVEQSEVVAVLRKCVEGGDLPNMLLYGPPGTGKTSTILAASRQIFGDMFKDR 95

  Fly    82 VLELNASNERGIDVVRNKIKMFAQQKVT--LPRGR----HKIVILDEADSMTEGAQQALRRTMEI 140
            :||||||:||||:|||.|||.|:|...:  .|.|:    .||:|||||||||..||.|||||||.
  Fly    96 ILELNASDERGINVVRTKIKNFSQLSASSVRPDGKPCPPFKIIILDEADSMTHAAQSALRRTMEK 160

  Fly   141 YSSTTRFALACNTSEKIIEPIQSRCAMLRFTKLSDAQVLAKLIEVAKWEKLNYTEDGLEAIVFTA 205
            .|.:|||.|.||...:||.||.|||:..||..|.:.:|:.:|..:.:.|.:...:|..::||..:
  Fly   161 ESRSTRFCLICNYVSRIIVPITSRCSKFRFKALGEDKVIDRLKYICEMEGVKIEDDAYKSIVKIS 225

  Fly   206 QGDMRQGLNNLQSTAQGFGDITAENVFKVCDEPHPKLLEEMIHHCAANDIHKAYKILAKLWKLGY 270
            .||:|:.:..|||..:..|   .|::....|      |.||                     .|.
  Fly   226 GGDLRRAITTLQSCYRLKG---PEHIINTAD------LFEM---------------------SGV 260

  Fly   271 SPEDIIANIFRVCKRINIDEHLKLDFIREIGIT 303
            .||..:.:...||:..|. |.|: .|:||||.:
  Fly   261 IPEYYLEDYLEVCRSGNY-ERLE-QFVREIGFS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC4NP_523915.1 PLN03025 16..330 CDD:178596 115/293 (39%)
AAA 31..165 CDD:99707 72/139 (52%)
Rep_fac_C 254..322 CDD:285713 13/50 (26%)
CG8142NP_573245.1 rfc 31..344 CDD:234763 115/293 (39%)
AAA 45..187 CDD:99707 74/141 (52%)
AAA_assoc_2 211..>256 CDD:292811 13/53 (25%)
Rep_fac_C <293..344 CDD:285713
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455787
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I449
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 1 1.000 - - FOG0000505
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11669
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.