DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC4 and Rad17

DIOPT Version :9

Sequence 1:NP_523915.1 Gene:RfC4 / 38492 FlyBaseID:FBgn0260985 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001019949.1 Gene:Rad17 / 310034 RGDID:1309515 Length:686 Species:Rattus norvegicus


Alignment Length:275 Identity:64/275 - (23%)
Similarity:116/275 - (42%) Gaps:68/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EKTADDKRSHLPWIEKYRPVKFKEIVGNEDTVAR---------LSVFATQGNAPNIIIAGPPGVG 61
            |..:||:    ||::||:|....|:..::..:..         |.|....|.: .::|.||||.|
  Rat    82 EYLSDDE----PWVDKYKPETQHELAVHKKKIEEVETWLKTQVLEVKPKHGGS-ILLITGPPGCG 141

  Fly    62 KTTTIQCLARIL-----------LGDSYKEAVLELNASNERGIDVV------------------R 97
            |||||:.|::.|           |.|..|:...|| .::|....|:                  .
  Rat   142 KTTTIKILSKELGIQVQEWVNPILQDFQKDDYKEL-FNSESNFSVIPYQSQIAVFNDFLLRATKY 205

  Fly    98 NKIKMFAQQKVTLPRGRHKIVILDEADSMTEGAQQALRRTMEIYSSTTRFAL--------ACNTS 154
            ||::|......|    ..||:::::..:.......||...:..|....|..|        :.:::
  Rat   206 NKLQMLGDALTT----DKKIILVEDLPNQFYRDANALHEILRKYVHIGRCPLVFIVSDSVSGDSN 266

  Fly   155 EKIIEP--IQSRCAM--LRFTKLSDAQVLAKL-----IEVAK-WEKLNY-TEDGLEAIVFTAQGD 208
            .:::.|  ||..|::  :.|..::...::..|     ||.:| .||:.. .:..||.:.....||
  Rat   267 HRLLFPKNIQEECSVSNISFNPVAPTIMMKFLNRIVTIEASKNGEKITVPNKASLELLCQGCSGD 331

  Fly   209 MRQGLNNLQ-STAQG 222
            :|..:|:|| |:::|
  Rat   332 IRSAINSLQFSSSKG 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC4NP_523915.1 PLN03025 16..330 CDD:178596 61/265 (23%)
AAA 31..165 CDD:99707 37/181 (20%)
Rep_fac_C 254..322 CDD:285713
Rad17NP_001019949.1 rad24 13..651 CDD:129690 64/275 (23%)
AAA_18 133..>253 CDD:289979 30/124 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.