DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC4 and Rfc4

DIOPT Version :9

Sequence 1:NP_523915.1 Gene:RfC4 / 38492 FlyBaseID:FBgn0260985 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001099339.1 Gene:Rfc4 / 288003 RGDID:1310142 Length:364 Species:Rattus norvegicus


Alignment Length:317 Identity:117/317 - (36%)
Similarity:175/317 - (55%) Gaps:10/317 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LPWIEKYRPVKFKEIVGNEDTVARLSVFATQGNAPNIIIAGPPGVGKTTTIQCLARILLG-DSYK 79
            :||:|||||....|:...|:.||.|.......:.||::..||||.|||:||...||.|.| :.::
  Rat    38 VPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFR 102

  Fly    80 EAVLELNASNERGIDVVRNKIKMFAQQKVTLPR--GR----HKIVILDEADSMTEGAQQALRRTM 138
            ..|||||||:||||.|||.|:|.|||..|:..|  |:    .||||||||||||..||.||||||
  Rat   103 LRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTM 167

  Fly   139 EIYSSTTRFALACNTSEKIIEPIQSRCAMLRFTKLSDAQVLAKLIEVAKWEKLNYTEDGLEAIVF 203
            |..|.||||.|.||...:||||:.|||:..||..|||.....:|:::|:.|.:...::.:..:|.
  Rat   168 EKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQKRLLDIAEKENVKIGDEEIAYLVR 232

  Fly   204 TAQGDMRQGLNNLQSTAQ--GFGDITAENVFKVCDEPHPKLLEEMIHHCAANDIHKAYKILAKLW 266
            .::||:|:.:..|||..:  |..:|:.:.:..:........:|.::..|.:....|...:|..|.
  Rat   233 ISEGDLRKAITFLQSATRLTGGKEISEDVITDIAGVIPAATIEGIVTACHSGSFDKLEAVLKNLI 297

  Fly   267 KLGYSPEDIIANIF-RVCKRINIDEHLKLDFIREIGITHMKIIDGINSLLQLTALLA 322
            ..|::...::..:. .:.:..|:.:..|.....::......:.||.:..|||.:|.|
  Rat   298 DEGHAATQLVNQLHDSIIEDENLSDKQKSIITEKLAEVDKCLADGADEHLQLMSLCA 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC4NP_523915.1 PLN03025 16..330 CDD:178596 117/317 (37%)
AAA 31..165 CDD:99707 75/140 (54%)
Rep_fac_C 254..322 CDD:285713 12/68 (18%)
Rfc4NP_001099339.1 rfc 39..354 CDD:234763 116/314 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 1 1.000 - - FOG0000505
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.