DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC4 and rfc3

DIOPT Version :9

Sequence 1:NP_523915.1 Gene:RfC4 / 38492 FlyBaseID:FBgn0260985 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_958865.1 Gene:rfc3 / 259256 ZFINID:ZDB-GENE-020809-3 Length:356 Species:Danio rerio


Alignment Length:360 Identity:96/360 - (26%)
Similarity:159/360 - (44%) Gaps:65/360 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WIEKYRPVKFKEIVGNEDTVARLSVFATQGNAPNIIIAGPPGVGKTTTIQCLARILLGDSYKEA- 81
            |::||||....::..:::...:|......|:.|::::.||.|.||.|.|.||.|.|.|...::. 
Zfish     4 WVDKYRPTSLAKLDYHKEQANQLKNLVQCGDFPHLLVYGPSGAGKKTRIMCLLRELYGAGVEKLR 68

  Fly    82 -----------------------VLELNASNERGID--VVRNKIKMFAQ-QKVTLPRGRH-KIVI 119
                                   .||:|.|:....|  |::..||..|| |::.....|. |:|:
Zfish    69 IEHQSITTPSKKKLEINTIASNYHLEVNPSDAGNSDRVVIQELIKTVAQSQQIQSSAQREFKVVL 133

  Fly   120 LDEADSMTEGAQQALRRTMEIYSSTTRFALACNTSEKIIEPIQSRCAMLRFTKLSDAQVLAKLIE 184
            |.|.|.:|:.||.|||||||.|.:|.|..|.||::.|:|.||:|||..:|....|..:|.:.|..
Zfish   134 LTEVDRLTKDAQHALRRTMEKYMATCRLILCCNSTSKVIAPIRSRCLAVRVPLPSVEEVCSVLSG 198

  Fly   185 VAKWEKLNYTEDGLEAIVFTAQGDMRQGLNNLQSTAQGFGDITAENVFKVC---------DEPHP 240
            |.:.|.|....:..:.|...:..::|:.|                .:.:.|         |:..|
Zfish   199 VCRKEGLLLPPELAKQIAEKSGRNLRKAL----------------LMCEACRVQQYPFSPDQDIP 247

  Fly   241 KLLEEMIHHCAANDI------HKAYKILAKLWKL---GYSPEDIIANIFRVCKRI-NIDEHLKLD 295
            :...|:.....||.|      .:..::.|:|::|   ..|||.|:..:  |.:.: |.|.|||.:
Zfish   248 ETDWEVYLRETANAIVSQQSPQRLLEVRARLYELLTHCISPEVIMKGL--VTELLSNCDGHLKAE 310

  Fly   296 FIREIGITHMKIIDGINSLLQLTALLAKLCIAAEK 330
            ..:.......::..|..::..|.|.:||.....:|
Zfish   311 VAQMAAYYEHRLQLGNKAIYHLEAFVAKFMAIYKK 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC4NP_523915.1 PLN03025 16..330 CDD:178596 95/358 (27%)
AAA 31..165 CDD:99707 53/161 (33%)
Rep_fac_C 254..322 CDD:285713 17/77 (22%)
rfc3NP_958865.1 rfc 3..345 CDD:234763 95/358 (27%)
AAA 21..179 CDD:99707 53/157 (34%)
Rep_fac_C 250..337 CDD:285713 20/88 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.