DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC4 and rfc3

DIOPT Version :9

Sequence 1:NP_523915.1 Gene:RfC4 / 38492 FlyBaseID:FBgn0260985 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001342879.1 Gene:rfc3 / 2541493 PomBaseID:SPAC27E2.10c Length:342 Species:Schizosaccharomyces pombe


Alignment Length:312 Identity:103/312 - (33%)
Similarity:172/312 - (55%) Gaps:2/312 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SHLPWIEKYRPVKFKEIVGNEDTVARLSVFATQGNAPNIIIAGPPGVGKTTTIQCLARILLGDSY 78
            |.|||:|||||...:::|.::|.::.|..|.:....|:::..||||.|||:||...||.:.|.:|
pombe    21 STLPWVEKYRPANLEDVVSHKDIISTLEKFISSNRVPHMLFYGPPGTGKTSTILACARKIYGPNY 85

  Fly    79 KEAVLELNASNERGIDVVRNKIKMFAQQKVTLPRGRHKIVILDEADSMTEGAQQALRRTMEIYSS 143
            :..::|||||::||||.||.:||.||..: .:.....|::||||||:||..||.||||.:|.|:.
pombe    86 RNQLMELNASDDRGIDAVREQIKNFASTR-QIFASTFKMIILDEADAMTLAAQNALRRVIEKYTK 149

  Fly   144 TTRFALACNTSEKIIEPIQSRCAMLRFTKLSDAQVLAKLIEVAKWEKLNYTEDGLEAIVFTAQGD 208
            ..||.:.||...||...|||||...||..|...::...:..|.:.|..|...|...|::..::||
pombe   150 NVRFCIICNYINKISPAIQSRCTRFRFQPLPPKEIEKTVDHVIQSEHCNIDPDAKMAVLRLSKGD 214

  Fly   209 MRQGLNNLQSTAQGFGDITAENVFKVCDEPHPKLLEEMIHHCAANDIHKAYKILAKL-WKLGYSP 272
            ||:.||.||:....:..|....::.....|||..::..:.....::...|:..::.: .:.|.:.
pombe   215 MRKALNILQACHAAYDHIDVSAIYNCVGHPHPSDIDYFLKSIMNDEFVIAFNTISSIKQQKGLAL 279

  Fly   273 EDIIANIFRVCKRINIDEHLKLDFIREIGITHMKIIDGINSLLQLTALLAKL 324
            :||:..||.....:.|..:.|:..:.::.....::..|.:..:||:|::|.:
pombe   280 QDILTCIFEALDELEIKPNAKIFILDQLATIEHRMSFGCSEKIQLSAMIASI 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC4NP_523915.1 PLN03025 16..330 CDD:178596 102/310 (33%)
AAA 31..165 CDD:99707 59/133 (44%)
Rep_fac_C 254..322 CDD:285713 12/68 (18%)
rfc3NP_001342879.1 Rad17 19..331 CDD:330523 103/310 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000505
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100321
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.