DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC4 and rfc-3

DIOPT Version :9

Sequence 1:NP_523915.1 Gene:RfC4 / 38492 FlyBaseID:FBgn0260985 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_502517.1 Gene:rfc-3 / 178259 WormBaseID:WBGene00004339 Length:354 Species:Caenorhabditis elegans


Alignment Length:229 Identity:72/229 - (31%)
Similarity:116/229 - (50%) Gaps:36/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WIEKYRPVKFKEIVGNEDT-----VARLSVFATQGNAPNIIIAGPPGVGKTTTIQCLARILLG-- 75
            |::||||   |:::|.:..     .|....|.:....|:::..||.|.||.|.|:||.|.|.|  
 Worm     4 WVDKYRP---KDLLGKDGVDYHIEQANHLKFLSADCMPHLLFCGPSGAGKKTRIKCLLRELYGVG 65

  Fly    76 -------------DSYKEAVLELNASN--------ERGI---DVVRNKIKMFAQ--QKVTLPRGR 114
                         .|.|:..::..:||        :.||   .||::.:|..||  |..:..:..
 Worm    66 VEKTQLIMKSFTSPSNKKLEIQTVSSNYHIEMTPSDVGIYDRVVVQDLVKEMAQTSQIESTSQRS 130

  Fly   115 HKIVILDEADSMTEGAQQALRRTMEIYSSTTRFALACNTSEKIIEPIQSRCAMLRFTKLSDAQVL 179
            .|:|:|.||||:|..||..||||||.|::..:..|:|.:..:||||:||||.::.....:|..|.
 Worm   131 FKVVVLCEADSLTRDAQHGLRRTMEKYANNCKIVLSCESLSRIIEPLQSRCIIINVPAPTDEDVT 195

  Fly   180 AKLIEVAKWEKLNYTEDGLEAIVFTAQGDMRQGL 213
            ..|.:|.:.|.....|:.|:.||..::|::|:.:
 Worm   196 KVLRKVIERESFLLPENVLQKIVEKSEGNLRRAI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC4NP_523915.1 PLN03025 16..330 CDD:178596 72/229 (31%)
AAA 31..165 CDD:99707 53/166 (32%)
Rep_fac_C 254..322 CDD:285713
rfc-3NP_502517.1 PRK12402 3..342 CDD:237090 72/229 (31%)
AAA 38..187 CDD:99707 52/148 (35%)
Rep_fac_C 253..340 CDD:285713
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.