DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ens and si:ch73-281i18.6

DIOPT Version :9

Sequence 1:NP_001097498.1 Gene:ens / 38491 FlyBaseID:FBgn0264693 Length:1241 Species:Drosophila melanogaster
Sequence 2:XP_002661062.1 Gene:si:ch73-281i18.6 / 100330842 ZFINID:ZDB-GENE-141219-21 Length:174 Species:Danio rerio


Alignment Length:137 Identity:45/137 - (32%)
Similarity:67/137 - (48%) Gaps:6/137 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1004 RVEREEAEKKAKEEAEKQRVEVAERLKREEKEREERRKRVEAIMLRTRKGGAAT-----TPSKDA 1063
            |.:|||||.||:|:||||.:|..:..::||.||.||:||:|.||.||||..|..     ||:: .
Zfish     5 RYKREEAESKAREKAEKQGIEREKHFQKEELERLERKKRLEEIMKRTRKSDAGAQKDVKTPTQ-V 68

  Fly  1064 NDKAAPAATAPENNSSSNSSVTGSSNNSAEGSPSAADSTPAPTATETVQEAPNSQAMYEQSVLDK 1128
            |.:...:......:.:.:|..|..|..|:....:|.....||........:.|..|...:.::..
Zfish    69 NGRVTDSVIQKNPSEALHSGATNQSPMSSVSWDAAPVINGAPPTKHQNGLSSNGDAADFEEIIKL 133

  Fly  1129 ENSLINS 1135
            .|...||
Zfish   134 SNHSGNS 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ensNP_001097498.1 MAP7 920..1060 CDD:283355 31/60 (52%)
si:ch73-281i18.6XP_002661062.1 MAP7 <8..61 CDD:283355 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576667
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.