DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and IQG1

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_015082.1 Gene:IQG1 / 855834 SGDID:S000006163 Length:1495 Species:Saccharomyces cerevisiae


Alignment Length:155 Identity:49/155 - (31%)
Similarity:73/155 - (47%) Gaps:21/155 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KINSKYSEELAQ--ESLEWIKAVTEEPINTS-----GDTDNFFEVLKDGVILCKLANALQPGSIK 75
            ||..:|.|.|.:  |...||:||.||.:.:.     ||:      |::||.|.||...:.|....
Yeast    99 KIELRYYEFLCRVSEVKIWIEAVIEEALPSEIELCVGDS------LRNGVFLAKLTQRINPDLTT 157

  Fly    76 KINES--KMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVVICLQSLGRKASNFNK 138
            .|..:  |:.||..:||:||....::.|||....|:..||:.::|:..|...|..|   .|..||
Yeast   158 VIFPAGDKLQFKHTQNINAFFGLVEHVGVPDSFRFELQDLYNKKNIPQVFETLHIL---ISMINK 219

  Fly   139 PSIGPKEADKNVR---NFSDEQLRA 160
            ...|...|..||.   :|:.|::.|
Yeast   220 KWPGKTPALTNVSGQISFTKEEIAA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 37/117 (32%)
Calponin 165..187 CDD:395325
IQG1NP_015082.1 IQG1 1..1494 CDD:227586 49/155 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.