Sequence 1: | NP_647860.1 | Gene: | Chd64 / 38490 | FlyBaseID: | FBgn0035499 | Length: | 188 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956014.1 | Gene: | tagln3b / 797861 | ZFINID: | ZDB-GENE-030131-4199 | Length: | 199 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 85/206 - (41%) |
---|---|---|---|
Similarity: | 112/206 - (54%) | Gaps: | 29/206 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 SNRAAKSGFAAEAQRKINSKYSEELAQESLEWIKAV----TEEPINTSGDTDNFFEVLKDGVILC 63
Fly 64 KLANALQPGS---IKKINESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVVIC 125
Fly 126 LQSLGRKASN------------FNKPSIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQS 178
Fly 179 GI-NFGNTRHM 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Chd64 | NP_647860.1 | CH_SF | 22..131 | CDD:412120 | 50/115 (43%) |
Calponin | 165..187 | CDD:395325 | 12/22 (55%) | ||
tagln3b | NP_956014.1 | SCP1 | 14..188 | CDD:227526 | 77/182 (42%) |
CH | 25..132 | CDD:278723 | 47/109 (43%) | ||
Calponin | 174..197 | CDD:278814 | 12/22 (55%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5199 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D488325at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2278 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |