DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and tagln3b

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_956014.1 Gene:tagln3b / 797861 ZFINID:ZDB-GENE-030131-4199 Length:199 Species:Danio rerio


Alignment Length:206 Identity:85/206 - (41%)
Similarity:112/206 - (54%) Gaps:29/206 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNRAAKSGFAAEAQRKINSKYSEELAQESLEWIKAV----TEEPINTSGDTDNFFEVLKDGVILC 63
            :||....|.:.|.|.||..||..||.....:||.|.    .|:|   .....||...|.||.|||
Zfish     2 ANRGPSYGLSREVQEKIEQKYDPELESRLEDWIVAQCGGNVEKP---QPGKQNFQNWLMDGTILC 63

  Fly    64 KLANALQPGS---IKKINESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVVIC 125
            :|.|:|.|..   ||||:|::||||.||.||.||..|:.:||.|.:.||:|||||.:::.:|...
Zfish    64 RLINSLYPRGKEPIKKISETQMAFKQMEKISQFLQAAEAYGVITTDIFQTVDLWEGKDMAAVQRT 128

  Fly   126 LQSLGRKASN------------FNKPSIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQS 178
            |.:||..|..            |::.|.|      |.|.||:||||.|.|:|.||.|||:||:||
Zfish   129 LMALGSVAITKDDGQYRGNREWFHRKSQG------NRREFSEEQLRQGQNLIGLQMGSNRGASQS 187

  Fly   179 GI-NFGNTRHM 188
            |: .:|..|.:
Zfish   188 GMTGYGMHRQI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 50/115 (43%)
Calponin 165..187 CDD:395325 12/22 (55%)
tagln3bNP_956014.1 SCP1 14..188 CDD:227526 77/182 (42%)
CH 25..132 CDD:278723 47/109 (43%)
Calponin 174..197 CDD:278814 12/22 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.