DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and tagln

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_021337144.1 Gene:tagln / 751758 ZFINID:ZDB-GENE-070912-1 Length:206 Species:Danio rerio


Alignment Length:198 Identity:77/198 - (38%)
Similarity:113/198 - (57%) Gaps:15/198 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNRAAKSGFAAEAQRKINSKYSEELAQESLEWIKAVTEEPINTSGDTD----NFFEVLKDGVILC 63
            :|:....|.:.:.|.||..||..||....:||:.|.....:   |..|    .|...||||.:||
Zfish     9 ANKGPSYGLSRQVQDKIEQKYDPELELRLVEWLVAQCGSAV---GRPDAGKLGFQAWLKDGCVLC 70

  Fly    64 KLANAL-QPGSIKKINESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVVICLQ 127
            :|.|:| :...:|||..|.||||.||.:|.||..|:.:||...:.||:|||||.::|.:|...|.
Zfish    71 ELINSLSKEKPVKKIQSSSMAFKQMEQVSQFLNAAEQYGVAKTDIFQTVDLWEGKDLAAVQRTLM 135

  Fly   128 SLG-----RKASNF-NKPSIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQSGI-NFGNT 185
            :||     ::...| ..|:...|:|.:|.|:|||:|::.|.|||.||.|||:||:|:|: .:|..
Zfish   136 ALGSIAVTKEDGAFRGDPNWFFKKAQENRRDFSDDQMKEGKNVIGLQMGSNRGASQAGMTGYGRP 200

  Fly   186 RHM 188
            |.:
Zfish   201 RQI 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 47/118 (40%)
Calponin 165..187 CDD:395325 11/22 (50%)
taglnXP_021337144.1 Calponin 21..193 CDD:332521 72/174 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578024
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm6375
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.