DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and Cnn1

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_113935.2 Gene:Cnn1 / 65204 RGDID:621883 Length:297 Species:Rattus norvegicus


Alignment Length:189 Identity:75/189 - (39%)
Similarity:110/189 - (58%) Gaps:11/189 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NRAAKSGFAAEAQRKINSKYSEELAQESLEWIKAVTEEPINTSGDTDNFFEVLKDGVILCKLANA 68
            ||....|.:||.:.|:..||..:..||..|||:.||...|.:     ||.:.||||:|||:..|.
  Rat     7 NRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGS-----NFMDGLKDGIILCEFINK 66

  Fly    69 LQPGSIKKINESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQN---LNSVVICLQSLG 130
            |||||:||:|||...:..:|||..|:.....:||...:.|::.||:|..|   :.|.::.|.|:.
  Rat    67 LQPGSVKKVNESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQVQSTLLALASMA 131

  Fly   131 RKASNFNKPSIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQSGIN-FGNTRHM 188
            :  :..||.::|.|.|:|..|.|..|:||.|.|:|.||.|:||.|:|.|:. :|..||:
  Rat   132 K--TKGNKVNVGVKYAEKQERRFEPEKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 44/111 (40%)
Calponin 165..187 CDD:395325 10/22 (45%)
Cnn1NP_113935.2 CH_CNN1 27..134 CDD:409131 42/113 (37%)
Calponin-like 1 164..189 12/25 (48%)
Calponin 164..188 CDD:395325 11/23 (48%)
Calponin-like 2 204..229
Calponin 204..228 CDD:395325
Calponin-like 3 243..268
Calponin 244..267 CDD:395325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338530
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4455
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm8915
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X194
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.