DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and cnn1b

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_701038.5 Gene:cnn1b / 572250 ZFINID:ZDB-GENE-091118-54 Length:296 Species:Danio rerio


Alignment Length:183 Identity:70/183 - (38%)
Similarity:106/183 - (57%) Gaps:9/183 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GFAAEAQRKINSKYSEELAQESLEWIKAVTEEPINTSGDTDNFFEVLKDGVILCKLANALQPGSI 74
            |.:||.:.|:..||..:..:|...||..||...:     .:||.|.|||||:||:|.|.|||||:
Zfish    12 GLSAEVKSKLAHKYDPQKEEELRMWISDVTGRKL-----PENFMEGLKDGVLLCELINTLQPGSV 71

  Fly    75 KKINESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQN---LNSVVICLQSLGRKASNF 136
            :|||.|...:..:|||..|:...:.:|:...|.|::.||:|..|   :.|.:|.|..:.:.....
Zfish    72 RKINNSPQNWHQLENIGNFVRAIQEYGLKPHEIFEANDLFENVNHTQVQSTLIALAGMAKSKGFH 136

  Fly   137 NKPSIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQSGI-NFGNTRHM 188
            :|..||.|.|:|..|.|:.|:|:.|.|:|.||.|:||.|:|.|: ::|..||:
Zfish   137 SKYDIGVKYAEKQQRRFAPEKLKEGRNIIGLQMGTNKFASQKGMTSYGTRRHL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 42/111 (38%)
Calponin 165..187 CDD:395325 10/22 (45%)
cnn1bXP_701038.5 SCP1 17..179 CDD:227526 63/166 (38%)
CH 30..126 CDD:278723 39/100 (39%)
Calponin 165..188 CDD:278814 10/22 (45%)
Calponin 205..228 CDD:278814
Calponin 245..267 CDD:278814
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578022
Domainoid 1 1.000 83 1.000 Domainoid score I8268
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I4555
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X194
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.