DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and Tagln3

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_062728.1 Gene:Tagln3 / 56370 MGIID:1926784 Length:199 Species:Mus musculus


Alignment Length:197 Identity:84/197 - (42%)
Similarity:116/197 - (58%) Gaps:11/197 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNRAAKSGFAAEAQRKINSKYSEELAQESLEWIKAVTEEPI-NTSGDTDNFFEVLKDGVILCKLA 66
            :||....|.:.|.|.||..||..:|..:.::||.....|.| :......:|.:.|.||.:||||.
Mouse     2 ANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLI 66

  Fly    67 NALQPGS---IKKINESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVVICLQS 128
            |:|.|..   |.||:|||||||.||.||.||..|:.:||.|.:.||:|||||.:::.:|...|.:
Mouse    67 NSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAEVYGVRTTDIFQTVDLWEGKDMAAVQRTLMA 131

  Fly   129 LGRKASNFN------KPSIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQSGI-NFGNTR 186
            ||..|...:      :||...::|.:|.|.||:||||.|.|||.||.||||||:|:|: .:|..|
Mouse   132 LGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPR 196

  Fly   187 HM 188
            .:
Mouse   197 QI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 48/112 (43%)
Calponin 165..187 CDD:395325 12/22 (55%)
Tagln3NP_062728.1 CH_TAGLN3 23..141 CDD:409130 48/117 (41%)
Calponin-like 174..199 13/25 (52%)
Calponin 174..198 CDD:395325 13/23 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..199 10/21 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834947
Domainoid 1 1.000 84 1.000 Domainoid score I8230
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4496
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm8680
orthoMCL 1 0.900 - - OOG6_102866
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.730

Return to query results.
Submit another query.