DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and tagln3a

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001096584.1 Gene:tagln3a / 563096 ZFINID:ZDB-GENE-060531-53 Length:213 Species:Danio rerio


Alignment Length:210 Identity:81/210 - (38%)
Similarity:110/210 - (52%) Gaps:37/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNRAAKSGFAAEAQRKINSKYSEELAQESLEWIKAVTEEPINTSGD--------TDNFFEVLKDG 59
            :||....|.:.|.|.||:.||..||....::||       :...||        ..||.:.|..|
Zfish     2 ANRGPSYGLSREVQEKIDQKYDAELESRLVDWI-------LIQCGDDLQRPEPGKQNFQKWLMSG 59

  Fly    60 VILCKLANALQPGS---IKKINESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNS 121
            .|||:|.|:|.|..   ||||.||||.||.||.||.||..|:.:||...:.||:|||||.:::.:
Zfish    60 TILCRLINSLYPSGEEPIKKITESKMVFKQMEKISQFLQFAEEYGVNRGDIFQTVDLWEGKDMAA 124

  Fly   122 VVICLQSLGRKASN------------FNKPSIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKG 174
            |...|.:||.:|..            |::.:.|.|      |.||:||||.|..||.:|.|||:|
Zfish   125 VQRTLMALGSEALTKDDGHYRGDPDWFHRKTKGHK------REFSEEQLRQGRVVIGMQMGSNRG 183

  Fly   175 ATQSG-INFGNTRHM 188
            |:||| :.:|..|.:
Zfish   184 ASQSGMVGYGTPRQI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 48/119 (40%)
Calponin 165..187 CDD:395325 11/22 (50%)
tagln3aNP_001096584.1 SCP1 14..188 CDD:227526 73/186 (39%)
CH 25..132 CDD:278723 45/113 (40%)
Calponin 174..197 CDD:278814 11/22 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578025
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm6375
orthoMCL 1 0.900 - - OOG6_102866
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X194
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.650

Return to query results.
Submit another query.