DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and Cnn3

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_038958917.1 Gene:Cnn3 / 54321 RGDID:71044 Length:374 Species:Rattus norvegicus


Alignment Length:174 Identity:67/174 - (38%)
Similarity:102/174 - (58%) Gaps:9/174 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 INSKYSEELAQESLEWIKAVTEEPINTSGDTDNFFEVLKDGVILCKLANALQPGSIKKINESKMA 83
            |.|||.::..::...||:.||...|.|     ||...||||:|||:|.|.|||||:||:|||.:.
  Rat    64 IASKYDQQAEEDLRNWIEEVTGMGIGT-----NFQLGLKDGIILCELINKLQPGSVKKVNESSLN 123

  Fly    84 FKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSV---VICLQSLGRKASNFNKPSIGPKE 145
            :..:|||..|:...:.:|:...:.|::.||:|..|:..|   ::.|..|.:.........||.|.
  Rat   124 WPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKY 188

  Fly   146 ADKNVRNFSDEQLRAGANVISLQYGSNKGATQSGIN-FGNTRHM 188
            |:|..|.|.:.:|:||.:||.||.|:||.|:|:|:. :|..||:
  Rat   189 AEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 42/111 (38%)
Calponin 165..187 CDD:395325 10/22 (45%)
Cnn3XP_038958917.1 CH_CNN3 67..177 CDD:409133 42/114 (37%)
Calponin 208..232 CDD:395325 11/23 (48%)
Calponin 248..272 CDD:395325
Calponin 287..311 CDD:395325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37533
Inparanoid 1 1.050 136 1.000 Inparanoid score I4455
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm8915
orthoMCL 1 0.900 - - OOG6_102866
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.