DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and cnn2

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_998841.1 Gene:cnn2 / 407907 XenbaseID:XB-GENE-1005289 Length:295 Species:Xenopus tropicalis


Alignment Length:189 Identity:70/189 - (37%)
Similarity:105/189 - (55%) Gaps:9/189 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NRAAKSGFAAEAQRKINSKYSEELAQESLEWIKAVTEEPINTSGDTDNFFEVLKDGVILCKLANA 68
            |:....|.:||.:.|:..||..:...|...||:.||...|.     .:|.:.||||||||:|.|.
 Frog     6 NKGPAYGLSAEVRNKLAQKYDPQKETELKVWIEEVTGMSIG-----PDFQKGLKDGVILCELMNK 65

  Fly    69 LQPGSIKKINESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVVICLQSLGRKA 133
            |:|.||.|:|.|:..:..:||:|.|:.....:|:.:.:.|::.||:|..|:..|.:.|.:|...|
 Frog    66 LRPHSIPKVNVSRQNWHQLENLSNFIKAMNLYGMKSVDLFEANDLFENGNMTQVQVSLLALAGLA 130

  Fly   134 SNFNKPS---IGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQSGIN-FGNTRHM 188
            .:....|   ||.|.::|..|||.|...:||..||.||.|:||.|:|||:. :|..||:
 Frog   131 KSRGMQSEVDIGVKYSEKQERNFDDNTKKAGHCVIGLQMGTNKCASQSGMTAYGTRRHL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 39/108 (36%)
Calponin 165..187 CDD:395325 11/22 (50%)
cnn2NP_998841.1 SCP1 17..189 CDD:227526 65/176 (37%)
Calponin 205..228 CDD:366078
Calponin 244..266 CDD:366078
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8045
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - otm47470
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.