DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and cnn2

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_021335293.1 Gene:cnn2 / 406658 ZFINID:ZDB-GENE-030131-542 Length:337 Species:Danio rerio


Alignment Length:223 Identity:74/223 - (33%)
Similarity:115/223 - (51%) Gaps:47/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NRAAKSGFAAEAQRKINSKYSEELAQESLEWIKAVTEEPINTSGDT--DNFFEVLKDGVILCKLA 66
            ||....||:||.:.||..||..:..:|...||:       ||:|.:  |:|.:.||:|||||:|.
Zfish     6 NRGPAYGFSAEVKSKIAQKYDPQREEELRIWIE-------NTTGRSIGDDFQKGLKNGVILCELI 63

  Fly    67 NALQPGSIKKINESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSV--------- 122
            |.|||||:||||:|...:..:||::.|:.....:|:...:.|::.||:|..|:..|         
Zfish    64 NKLQPGSVKKINQSSQNWHQLENLTNFIKAITTYGLKPHDIFEANDLFENGNMTQVQTTLLALAG 128

  Fly   123 --------------------------VICLQSLGRKASNFNKPSIGPKEADKNVRNFSDEQLRAG 161
                                      ::|||:  :.....:...||.|.|::..|.|.||:::||
Zfish   129 MVSPVQSYHFTGEQPNLDISDCNYRFLLCLQA--KTKGIHSSVDIGVKYAERQERAFDDEKMKAG 191

  Fly   162 ANVISLQYGSNKGATQSGIN-FGNTRHM 188
            ..||.||.|:||.|:|:|:| :|..||:
Zfish   192 QCVIGLQMGTNKCASQAGMNAYGTRRHL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 42/145 (29%)
Calponin 165..187 CDD:395325 11/22 (50%)
cnn2XP_021335293.1 CH 27..129 CDD:306753 37/108 (34%)
Calponin 195..218 CDD:306832 11/22 (50%)
Calponin 235..257 CDD:306832
Calponin 274..296 CDD:306832
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578015
Domainoid 1 1.000 83 1.000 Domainoid score I8268
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I4555
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm6375
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.