DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and cnn3

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_989257.1 Gene:cnn3 / 394869 XenbaseID:XB-GENE-951266 Length:331 Species:Xenopus tropicalis


Alignment Length:189 Identity:76/189 - (40%)
Similarity:113/189 - (59%) Gaps:9/189 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NRAAKSGFAAEAQRKINSKYSEELAQESLEWIKAVTEEPINTSGDTDNFFEVLKDGVILCKLANA 68
            |:....|.:||.:.||..||..::.:|...||:.||...|.     :||.:.|:||:|||.|.|.
 Frog     5 NKGPAYGLSAEVKNKIAQKYDPQVEEELRLWIEEVTGMIIG-----ENFQQGLRDGIILCNLINK 64

  Fly    69 LQPGSIKKINESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVVICLQSLG--R 131
            |||||||||||:|:.:..:|||..|:...:::|:...:.|::.||:|..|:..|...|.||.  .
 Frog    65 LQPGSIKKINEAKLNWHKLENIGNFIKAMQDYGMKPHDIFEANDLFENGNMTQVQTSLVSLAGLA 129

  Fly   132 KASNFN-KPSIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQSGIN-FGNTRHM 188
            |...|: ...||.|.|:|..|.|.||:::||.:||.||.|:||.|:|:|:. :|..||:
 Frog   130 KTRGFHTSVDIGVKYAEKQKRQFGDEKMKAGQSVIGLQMGTNKCASQAGMTAYGTRRHL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 44/110 (40%)
Calponin 165..187 CDD:395325 10/22 (45%)
cnn3NP_989257.1 CH 27..126 CDD:366016 41/103 (40%)
Calponin 164..187 CDD:366078 10/22 (45%)
Calponin 204..226 CDD:366078
Calponin 243..266 CDD:366078
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8045
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37533
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - otm47470
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.