DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and Tagln2

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_038946728.1 Gene:Tagln2 / 304983 RGDID:1310840 Length:207 Species:Rattus norvegicus


Alignment Length:202 Identity:83/202 - (41%)
Similarity:119/202 - (58%) Gaps:21/202 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNRAAKSGFAAEAQRKINSKYSEELAQESLEWI-----KAVTE-EPINTSGDTDNFFEVLKDGVI 61
            :||....|.:.|.|:||..:|..:|.|..::||     |.|:: :|     ..:||...||||.:
  Rat    10 ANRGPSYGLSREVQQKIEKQYDPDLEQILIQWITTQCRKGVSQPQP-----GRENFQNWLKDGTV 69

  Fly    62 LCKLANALQP---GSIKKINESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVV 123
            ||:|.|:|.|   ..:|||..|.||||.||.||.||..|:.:|:.|.:.||:|||||.:|:..|.
  Rat    70 LCELINSLYPEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQ 134

  Fly   124 ICLQSLG-----RKASNFN-KPSIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQSGI-N 181
            ..|.:||     |....|: .|:..||::.:|.|||||.||:.|.|||.||.|:|:||:|:|: .
  Rat   135 RTLMNLGGLAVARDDGLFSGDPNWFPKKSKENPRNFSDNQLQEGKNVIGLQMGTNRGASQAGMTG 199

  Fly   182 FGNTRHM 188
            :|..|.:
  Rat   200 YGMPRQI 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 49/122 (40%)
Calponin 165..187 CDD:395325 10/22 (45%)
Tagln2XP_038946728.1 CH_TAGLN2 26..162 CDD:409129 54/140 (39%)
Calponin 182..206 CDD:395325 11/23 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338532
Domainoid 1 1.000 80 1.000 Domainoid score I8379
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm8915
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X194
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.