DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and tagln2

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_963870.1 Gene:tagln2 / 259183 ZFINID:ZDB-GENE-020802-2 Length:201 Species:Danio rerio


Alignment Length:196 Identity:77/196 - (39%)
Similarity:112/196 - (57%) Gaps:10/196 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNRAAKSGFAAEAQRKINSKYSEELAQESLEWIKAVTEEPI-NTSGDTDNFFEVLKDGVILCKLA 66
            :|:....|.:.|.|.||:.||..||....::||.:...|.| ........|.:.||||.|||:|.
Zfish     2 ANKGPSYGLSREVQSKIDKKYDPELEGRLVQWIVSQCGEAIGKPQPGKQGFQQWLKDGCILCELI 66

  Fly    67 NALQPGS--IKKINESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVVICLQSL 129
            |:|...|  :|||..|.||||.||.||.||..|:.:|:...:.||:|||||.::|.:|.:.|.||
Zfish    67 NSLFKDSKPVKKIQSSSMAFKQMEQISQFLTAAERYGITKSDIFQTVDLWEGKDLAAVQMTLLSL 131

  Fly   130 GRKASNFN------KPSIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQSGI-NFGNTRH 187
            |..|...:      .|:..||::.:|.|.||:||::.|.:||.|..|:|.||:|:|: .:|..|.
Zfish   132 GSLAVTKDDGCYRGDPAWFPKKSHENRREFSEEQMKEGHSVIGLHMGTNIGASQAGMTGYGRPRQ 196

  Fly   188 M 188
            :
Zfish   197 I 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 48/111 (43%)
Calponin 165..187 CDD:395325 9/22 (41%)
tagln2NP_963870.1 SCP1 14..187 CDD:227526 71/172 (41%)
CH 25..131 CDD:278723 44/105 (42%)
Calponin 173..196 CDD:278814 9/22 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578023
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm6375
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X194
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.