DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and rng2

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_593860.1 Gene:rng2 / 2543129 PomBaseID:SPAC4F8.13c Length:1489 Species:Schizosaccharomyces pombe


Alignment Length:153 Identity:44/153 - (28%)
Similarity:77/153 - (50%) Gaps:20/153 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KINSKYSEEL--------AQESLEWIKAVTEEPINTS-GDTDNFFEVLKDGVILCKLANALQPGS 73
            ::.:|..|.|        ..|:.:||    ||.:.|. |.|..|.:.|::||:|..|....||..
pombe    26 RLAAKQRETLQAYDYLCRVDEAKKWI----EECLGTDLGPTSTFEQSLRNGVVLALLVQKFQPDK 86

  Fly    74 IKKI-NESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVVICLQSLGRKAS--N 135
            :.|| ..:::.|:..:||:.||......|:|....|:..|::|.:||..|:.|:.:|....|  :
pombe    87 LIKIFYSNELQFRHSDNINKFLDFIHGIGLPEIFHFELTDIYEGKNLPKVIYCIHALSYFLSMQD 151

  Fly   136 FNKPSIGPKEADKNVRNFSDEQL 158
            ...|.|   ::|:|: :|:||.:
pombe   152 LAPPLI---KSDENL-SFTDEDV 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 36/118 (31%)
Calponin 165..187 CDD:395325
rng2NP_593860.1 IQG1 1..1489 CDD:227586 44/153 (29%)
CH 42..145 CDD:237981 33/106 (31%)
RasGAP_IQGAP_related 846..1217 CDD:213345
RasGAP_C 1274..1410 CDD:281787
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.