DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and Tagln

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_113737.1 Gene:Tagln / 25123 RGDID:3723 Length:201 Species:Rattus norvegicus


Alignment Length:198 Identity:72/198 - (36%)
Similarity:109/198 - (55%) Gaps:12/198 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNRAAKSGFAAEAQRKINSKYSEELAQESLEWIKAVTEEPINTSGDTDNFFEV-LKDGVILCKLA 66
            :|:....|.:.|.|.||..||.|||.:..:|||.......:.........|:| ||:||||.||.
  Rat     2 ANKGPSYGMSREVQSKIEKKYDEELEERLVEWIVMQCGPDVGRPDRGRLGFQVWLKNGVILSKLV 66

  Fly    67 NALQPGSIKKI----NESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVVICLQ 127
            |:|.|...|.:    |...|.||.||.::.||..|:::||...:.||:|||:|.:::.:|...:.
  Rat    67 NSLYPEGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVTKTDMFQTVDLFEGKDMAAVQRTVM 131

  Fly   128 SLGRKASNFN------KPSIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQSGI-NFGNT 185
            :||..|...|      .|:...|:|.::.|.|:|.||:.|.:||.||.|||:||:|:|: .:|..
  Rat   132 ALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTDSQLQEGKHVIGLQMGSNRGASQAGMTGYGRP 196

  Fly   186 RHM 188
            |.:
  Rat   197 RQI 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 41/113 (36%)
Calponin 165..187 CDD:395325 11/22 (50%)
TaglnNP_113737.1 CH_TAGLN 23..143 CDD:409128 42/119 (35%)
Could be involved in actin-binding 154..161 2/6 (33%)
Calponin-like 175..200 12/25 (48%)
Calponin 175..199 CDD:395325 12/23 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338531
Domainoid 1 1.000 80 1.000 Domainoid score I8379
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm8915
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.