DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd64 and Tagln2

DIOPT Version :9

Sequence 1:NP_647860.1 Gene:Chd64 / 38490 FlyBaseID:FBgn0035499 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_848713.1 Gene:Tagln2 / 21346 MGIID:1312985 Length:199 Species:Mus musculus


Alignment Length:197 Identity:82/197 - (41%)
Similarity:116/197 - (58%) Gaps:11/197 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNRAAKSGFAAEAQRKINSKYSEELAQESLEWIKAVTEEPI-NTSGDTDNFFEVLKDGVILCKLA 66
            :||....|.:.|.|:||..:|..:|.|..::||.....|.: ......:||.:.||||.:||||.
Mouse     2 ANRGPSYGLSREVQQKIEKQYDADLEQILIQWITTQCREDVGQPQPGRENFQKWLKDGTVLCKLI 66

  Fly    67 NALQP---GSIKKINESKMAFKCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVVICLQS 128
            |:|.|   ..:|||..|.||||.||.||.||..|:.:|:.|.:.||:|||||.:|:..|...|.:
Mouse    67 NSLYPEGQAPVKKIQASSMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLMN 131

  Fly   129 LG-----RKASNFN-KPSIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQSGI-NFGNTR 186
            ||     |....|: .|:..||::.:|.|||||.||:.|.|||.||.|:|:||:|:|: .:|..|
Mouse   132 LGGLAVARDDGLFSGDPNWFPKKSKENPRNFSDNQLQEGKNVIGLQMGTNRGASQAGMTGYGMPR 196

  Fly   187 HM 188
            .:
Mouse   197 QI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd64NP_647860.1 CH_SF 22..131 CDD:412120 48/117 (41%)
Calponin 165..187 CDD:395325 10/22 (45%)
Tagln2NP_848713.1 SCP1 14..188 CDD:227526 75/173 (43%)
CH 25..136 CDD:237981 47/110 (43%)
Calponin-like 174..199 11/25 (44%)
Calponin 174..197 CDD:278814 10/22 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834946
Domainoid 1 1.000 84 1.000 Domainoid score I8230
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4496
Isobase 1 0.950 - 0 Normalized mean entropy S1711
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm8680
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.